PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016494916.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 356aa    MW: 41119.1 Da    PI: 8.8049
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016494916.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.56.8e-151094198
                    EEEE-..-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  1 ffkvltpsdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                    ffk +     +k++ l +p  f+ ++  g++   +++  +  ++g++W vkl  ++++    +++GW eF+++++L+ gD++vF+++g++ef   v+
  XP_016494916.1 10 FFKPM--LPGFKHD-LKIPIGFL-KYlkGYD---HIEHAVLKRDGKKWLVKL--TGRR----FEAGWAEFAEEHDLQLGDMLVFRHEGNMEF--DVS 91
                    77777..7788888.********.6655444...56789999**********..8887....9***********************999999..888 PP

                    EE- CS
              B3 96 vfr 98
                    +f 
  XP_016494916.1 92 IFG 94
                    886 PP

2B350.24.7e-16141228495
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                      +++++  ++g l+lpk+fa ++g+ +++   l+++de+ rsW+++l  + +++++++++ W eF  an++k+g  ++F+++++ ++++v k
  XP_016494916.1 141 CTVKPYCVTNGFLRLPKQFAWANGLANKK-CGLIIRDERQRSWDLRL--TTYGSQVYMGGRWGEFRAANDIKVGNYIMFEVVSN-GEQPVWK 228
                     567899999**************666433.46999************..9***9**************************8875.4445555 PP

3B356.64.7e-18250339598
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                     +++++ l++++l++p++fa ++g+++++  +l+++de+ rsW+++l  r  + ++ +++GW eF + n LkegD +vF+++  +++++  +++r
  XP_016494916.1 250 TIRPYCLSNDLLCIPRQFAHANGLINKK-CDLIIRDERQRSWSLRL--RSFGTGVCIKGGWHEFRDTNCLKEGDHIVFEVVT-NGEKPIWQFRR 339
                     678999****************988654.59***************..999999*************************876.56666766666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-20398IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.26E-215102IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.026796IPR003340B3 DNA binding domain
CDDcd100171.95E-16893No hitNo description
PfamPF023624.5E-111093IPR003340B3 DNA binding domain
SMARTSM010191.2E-141096IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.7E-16136229IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.24E-17136230IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.364138232IPR003340B3 DNA binding domain
SMARTSM010191.8E-16138233IPR003340B3 DNA binding domain
PfamPF023622.3E-13140227IPR003340B3 DNA binding domain
CDDcd100178.63E-11144217No hitNo description
Gene3DG3DSA:2.40.330.102.5E-20239340IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.04E-21244343IPR015300DNA-binding pseudobarrel domain
CDDcd100173.09E-13245325No hitNo description
PROSITE profilePS5086312.858246340IPR003340B3 DNA binding domain
SMARTSM010195.2E-17247341IPR003340B3 DNA binding domain
PfamPF023623.8E-16250339IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MKIPPKKPHF FKPMLPGFKH DLKIPIGFLK YLKGYDHIEH AVLKRDGKKW LVKLTGRRFE  60
AGWAEFAEEH DLQLGDMLVF RHEGNMEFDV SIFGSNHCER EYAEYLEEGE VHTVEETSKN  120
FEFKDAAAAL HNPFGQSYFI CTVKPYCVTN GFLRLPKQFA WANGLANKKC GLIIRDERQR  180
SWDLRLTTYG SQVYMGGRWG EFRAANDIKV GNYIMFEVVS NGEQPVWKFH GKPNPSINSS  240
SKAFPHFVCT IRPYCLSNDL LCIPRQFAHA NGLINKKCDL IIRDERQRSW SLRLRSFGTG  300
VCIKGGWHEF RDTNCLKEGD HIVFEVVTNG EKPIWQFRRN ISGENASISF KGLTEQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016494916.10.0PREDICTED: B3 domain-containing protein REM10-like isoform X1
TrEMBLK4CIB31e-149K4CIB3_SOLLC; Uncharacterized protein
STRINGSolyc08g006240.1.11e-149(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32215171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.11e-42B3 family protein